Lineage for d1gcea_ (1gce A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054419Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1054426Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (8 PDB entries)
    Uniprot P05364 22-380 ! Uniprot P05364 22-381
  8. 1054431Domain d1gcea_: 1gce A: [42738]

Details for d1gcea_

PDB Entry: 1gce (more details), 1.8 Å

PDB Description: structure of the beta-lactamase of enterobacter cloacae gc1
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1gcea_:

Sequence, based on SEQRES records: (download)

>d1gcea_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]}
tpvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
elgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplq
vpdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlk
plkldhtwinvpkaeeahyawgyrdgkavravrvspgmldaqaygvktnvqdmanwvman
mapenvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplp
vaevnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhil
ealq

Sequence, based on observed residues (ATOM records): (download)

>d1gcea_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]}
tpvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
elgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplq
vpdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlk
plkldhtwinvpkaeeahyawgyrdgkavravrpgmldaqaygvktnvqdmanwvmanma
penvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpva
evnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhilea
lq

SCOPe Domain Coordinates for d1gcea_:

Click to download the PDB-style file with coordinates for d1gcea_.
(The format of our PDB-style files is described here.)

Timeline for d1gcea_: