Lineage for d1fr1b_ (1fr1 B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244171Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 2244194Species Citrobacter freundii [TaxId:546] [56619] (3 PDB entries)
  8. 2244197Domain d1fr1b_: 1fr1 B: [42735]

Details for d1fr1b_

PDB Entry: 1fr1 (more details), 2 Å

PDB Description: refined crystal structure of beta-lactamase from citrobacter freundii indicates a mechanism for beta-lactam hydrolysis
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d1fr1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fr1b_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Citrobacter freundii [TaxId: 546]}
aakteqqiadivnrtitplmqeqaipgmavaiiyqgkpyyftwgkadiannrpvtqqtlf
elgsvsktfngvlggdaiargeiklsdpvtqywpeltgkqwqgisllhlatytagglplq
vpddvtdkaallrfyqnwqpqwapgakrlyanssiglfgalavkpsgmsyeeamskrvlh
plklahtwitvpqseqkdyawgyregkpvhvspgqldaeaygvkssvidmtrwvqanmda
sqvqektlqqgielaqsrywrigdmyqglgwemlnwpvkadsiisgsdskvalaalpave
vnppapavkaswvhktgstggfgsyvafvpeknlgivmlanksypnpvrveaawrilekl
q

SCOPe Domain Coordinates for d1fr1b_:

Click to download the PDB-style file with coordinates for d1fr1b_.
(The format of our PDB-style files is described here.)

Timeline for d1fr1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fr1a_