Lineage for d1e25a_ (1e25 A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690477Protein beta-Lactamase, class A [56606] (16 species)
  7. 1690624Species Pseudomonas aeruginosa, PER-1 [TaxId:287] [56616] (1 PDB entry)
  8. 1690625Domain d1e25a_: 1e25 A: [42731]
    complexed with so4

Details for d1e25a_

PDB Entry: 1e25 (more details), 1.9 Å

PDB Description: the high resolution structure of per-1 class a beta-lactamase
PDB Compounds: (A:) extended-spectrum beta-lactamase per-1

SCOPe Domain Sequences for d1e25a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e25a_ e.3.1.1 (A:) beta-Lactamase, class A {Pseudomonas aeruginosa, PER-1 [TaxId: 287]}
spllkeqiesivigkkatvgvavwgpddlepllinpfekfpmqsvfklhlamlvlhqvdq
gkldlnqtvivnrakvlqntwapimkayqgdefsvpvqqllqysvshsdnvacdllfelv
ggpaalhdyiqsmgiketavvaneaqmhaddqvqyqnwtsmkgaaeilkkfeqktqlset
sqallwkwmvetttgperlkgllpagtvvahktgtsqikagktaatndlgiillpdgrpl
lvavfvkdsaessrtneaiiaqvaqtayqfelkklsal

SCOPe Domain Coordinates for d1e25a_:

Click to download the PDB-style file with coordinates for d1e25a_.
(The format of our PDB-style files is described here.)

Timeline for d1e25a_: