Lineage for d1bsga_ (1bsg A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244418Protein beta-Lactamase, class A [56606] (16 species)
  7. 2244679Species Streptomyces albus G [TaxId:1962] [56614] (1 PDB entry)
  8. 2244680Domain d1bsga_: 1bsg A: [42729]
    complexed with act

Details for d1bsga_

PDB Entry: 1bsg (more details), 1.85 Å

PDB Description: beta-lactamase from streptomyces albus g
PDB Compounds: (A:) beta lactamase

SCOPe Domain Sequences for d1bsga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsga_ e.3.1.1 (A:) beta-Lactamase, class A {Streptomyces albus G [TaxId: 1962]}
sdaerrlaglerasgarlgvyaydtgsgrtvayradelfpmcsvfktlssaavlrdldrn
geflsrrilytqddveqadgapetgkpqnlangmtveelcevsitasdncaanlmlrelg
gpaavtrfvrslgdrvtrldrwepelnsaepgrvtdttspraitrtygrlvlgdalnprd
rrlltswllanttsgdrfraglpddwtlgdktgagrygtnndagvtwppgrapivltvlt
akteqdaarddglvadaarvlaetlg

SCOPe Domain Coordinates for d1bsga_:

Click to download the PDB-style file with coordinates for d1bsga_.
(The format of our PDB-style files is described here.)

Timeline for d1bsga_: