Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein beta-Lactamase, class A [56606] (16 species) |
Species Streptomyces albus G [TaxId:1962] [56614] (1 PDB entry) |
Domain d1bsga_: 1bsg A: [42729] complexed with act |
PDB Entry: 1bsg (more details), 1.85 Å
SCOPe Domain Sequences for d1bsga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bsga_ e.3.1.1 (A:) beta-Lactamase, class A {Streptomyces albus G [TaxId: 1962]} sdaerrlaglerasgarlgvyaydtgsgrtvayradelfpmcsvfktlssaavlrdldrn geflsrrilytqddveqadgapetgkpqnlangmtveelcevsitasdncaanlmlrelg gpaavtrfvrslgdrvtrldrwepelnsaepgrvtdttspraitrtygrlvlgdalnprd rrlltswllanttsgdrfraglpddwtlgdktgagrygtnndagvtwppgrapivltvlt akteqdaarddglvadaarvlaetlg
Timeline for d1bsga_: