SCOPe 2.04: Domain d1mblb_: 1mbl B:

Lineage for d1mblb_ (1mbl B:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Bacillus licheniformis [TaxId:1402] [56612] (11 PDB entries)

8. Domain d1mblb_: 1mbl B: [42724]
   complexed with so4; mutant

Details for d1mblb_

PDB Entry: 1mbl, 2 Å

PDB Description: a catalytically-impaired class a beta-lactamase: 2 angstroms crystal structure and kinetics of the bacillus licheniformis e166a mutant

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d1mblb_:

Sequence; same for both SEQRES and ATOM records:

>d1mblb_ e.3.1.1 (B:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfapelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln

Timeline for d1mblb_:

• d1mblb_ first appeared (with stable ids) in SCOP 1.55
  
• d1mblb_ appears in SCOPe 2.03
  
• d1mblb_ appears in SCOPe 2.05
  
• d1mblb_ appears in the current release, SCOPe 2.08