SCOPe 2.04: Domain d4blmb_: 4blm B:

Lineage for d4blmb_ (4blm B:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Bacillus licheniformis [TaxId:1402] [56612] (11 PDB entries)

8. Domain d4blmb_: 4blm B: [42722]
   complexed with so4

Details for d4blmb_

PDB Entry: 4blm, 2 Å

PDB Description: beta-lactamase of bacillus licheniformis 749(slash)c. refinement at 2 angstroms resolution and analysis of hydration

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d4blmb_:

Sequence; same for both SEQRES and ATOM records:

>d4blmb_ e.3.1.1 (B:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln

Timeline for d4blmb_:

• d4blmb_ first appeared (with stable ids) in SCOP 1.55
  
• d4blmb_ appears in SCOPe 2.03
  
• d4blmb_ appears in SCOPe 2.05
  
• d4blmb_ appears in the current release, SCOPe 2.08