Lineage for d1kgga_ (1kgg A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690477Protein beta-Lactamase, class A [56606] (16 species)
  7. 1690632Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries)
  8. 1690643Domain d1kgga_: 1kgg A: [42715]
    complexed with so4; mutant

Details for d1kgga_

PDB Entry: 1kgg (more details), 2.3 Å

PDB Description: structure of beta-lactamase glu166gln:asn170asp mutant
PDB Compounds: (A:) protein (beta-lactamase)

SCOPe Domain Sequences for d1kgga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgga_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus [TaxId: 1280]}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvryqieldyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef

SCOPe Domain Coordinates for d1kgga_:

Click to download the PDB-style file with coordinates for d1kgga_.
(The format of our PDB-style files is described here.)

Timeline for d1kgga_: