Lineage for d1cefa_ (1cef A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690753Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)
  7. 1690762Species Streptomyces sp., R61 [TaxId:1931] [56605] (14 PDB entries)
    Uniprot P15555 34-378 ! Uniprot P15555
  8. 1690776Domain d1cefa_: 1cef A: [42689]
    complexed with cef

Details for d1cefa_

PDB Entry: 1cef (more details), 2.04 Å

PDB Description: cefotaxime complexed with the streptomyces r61 dd-peptidase
PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase transpeptidase

SCOPe Domain Sequences for d1cefa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cefa_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61 [TaxId: 1931]}
adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv
gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf
aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva
teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav
isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg
tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

SCOPe Domain Coordinates for d1cefa_:

Click to download the PDB-style file with coordinates for d1cefa_.
(The format of our PDB-style files is described here.)

Timeline for d1cefa_: