SCOPe 2.05: Domain d1skfa_: 1skf A:

Lineage for d1skfa_ (1skf A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)

7. Species Streptomyces sp., K15 [TaxId:1931] [56604] (7 PDB entries)

8. Domain d1skfa_: 1skf A: [42684]

Details for d1skfa_

PDB Entry: 1skf, 2 Å

PDB Description: crystal structure of the streptomyces k15 dd-transpeptidase

PDB Compounds: (A:) d-alanyl-d-alanine transpeptidase

SCOPe Domain Sequences for d1skfa_:

Sequence; same for both SEQRES and ATOM records:

>d1skfa_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., K15 [TaxId: 1931]}
vtkptiaavggyamnngtgttlytkaadtrrstgsttkimtakvvlaqsnlnldakvtiq
kaysdyvvannasqahlivgdkvtvrqllyglmlpsgcdaayaladkygsgstraarvks
figkmntaatnlglhnthfdsfdgignganystprdltkiassamknstfrtvvktkayt
aktvtktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvl
astsiparesdatkimnygfal

Timeline for d1skfa_:

• d1skfa_ first appeared (with stable ids) in SCOP 1.55, called d1skf__
  
• d1skfa_ appears in SCOPe 2.04
  
• d1skfa_ appears in SCOPe 2.06
  
• d1skfa_ appears in the current release, SCOPe 2.08