SCOP 1.75: Domain d1seka_: 1sek A:

Lineage for d1seka_ (1sek A:)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.1: Serpins [56573] (1 superfamily)
   contains a cluster of helices and a beta-sandwich

4. Superfamily e.1.1: Serpins [56574] (1 family)

5. Family e.1.1.1: Serpins [56575] (16 proteins)

6. Protein Serpin K [56591] (1 species)

7. Species Tobacco hawkmoth (Manduca sexta) [TaxId:7130] [56592] (1 PDB entry)

8. Domain d1seka_: 1sek A: [42675]

Details for d1seka_

PDB Entry: 1sek, 2.1 Å

PDB Description: the structure of active serpin k from manduca sexta and a model for serpin-protease complex formation

PDB Compounds: (A:) serpin k

SCOP Domain Sequences for d1seka_:

Sequence; same for both SEQRES and ATOM records:

>d1seka_ e.1.1.1 (A:) Serpin K {Tobacco hawkmoth (Manduca sexta) [TaxId: 7130]}
getdlqkilresndqftaqmfsevvkanpgqnvvlsafsvlpplgqlalasvgeshdell
ralalpndnvtkdvfadlnrgvravkgvdlkmaskiyvakglelnddfaavsrdvfgsev
qnvdfvksveaagainkwvedqtnnriknlvdpdaldettrsvlvnaiyfkgswkdkfnk
ertmdrdfhvskdktikvptmigkkdvryadvpeldakmiemsyegdqasmiiilpnqvd
gitaleqklkdpkalsraeerlynteveiylpkfkietttdlkevlsnmnikklftpgaa
rlenllktkeslyvdaaiqkafievneegaeaaaanafkittysfhfvpkveinkpfffs
lkynrnsmfsgvcvqp

Timeline for d1seka_:

• d1seka_ first appeared (with stable ids) in SCOP 1.55, called d1sek__
  
• d1seka_ appears in SCOP 1.73
  
• d1seka_ appears in SCOPe 2.01
  
• d1seka_ appears in the current release, SCOPe 2.08