SCOP 1.71: Domain d1sek__: 1sek -

Lineage for d1sek__ (1sek -)

1. Root: SCOP 1.71

2. Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)

3. Fold e.1: Serpins [56573] (1 superfamily)
   contains a cluster of helices and a beta-sandwich

4. Superfamily e.1.1: Serpins [56574] (1 family)

5. Family e.1.1.1: Serpins [56575] (16 proteins)

6. Protein Serpin K [56591] (1 species)

7. Species Tobacco hawkmoth (Manduca sexta) [TaxId:7130] [56592] (1 PDB entry)

8. Domain d1sek__: 1sek - [42675]

Details for d1sek__

PDB Entry: 1sek, 2.1 Å

PDB Description: the structure of active serpin k from manduca sexta and a model for serpin-protease complex formation

SCOP Domain Sequences for d1sek__:

Sequence; same for both SEQRES and ATOM records:

>d1sek__ e.1.1.1 (-) Serpin K {Tobacco hawkmoth (Manduca sexta)}
getdlqkilresndqftaqmfsevvkanpgqnvvlsafsvlpplgqlalasvgeshdell
ralalpndnvtkdvfadlnrgvravkgvdlkmaskiyvakglelnddfaavsrdvfgsev
qnvdfvksveaagainkwvedqtnnriknlvdpdaldettrsvlvnaiyfkgswkdkfnk
ertmdrdfhvskdktikvptmigkkdvryadvpeldakmiemsyegdqasmiiilpnqvd
gitaleqklkdpkalsraeerlynteveiylpkfkietttdlkevlsnmnikklftpgaa
rlenllktkeslyvdaaiqkafievneegaeaaaanafkittysfhfvpkveinkpfffs
lkynrnsmfsgvcvqp

Timeline for d1sek__:

• d1sek__ first appeared (with stable ids) in SCOP 1.55
  
• d1sek__ appears in SCOP 1.69
  
• d1sek__ is called d1seka_ in SCOP 1.73
  
• d1sek__ appears in the current release, SCOPe 2.08, called d1seka_