Lineage for d1dzhi_ (1dzh I:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 338537Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 338538Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 338539Family e.1.1.1: Serpins [56575] (15 proteins)
  6. 338550Protein Antithrombin [56584] (2 species)
  7. 338554Species Human (Homo sapiens) [TaxId:9606] [56586] (12 PDB entries)
  8. 338567Domain d1dzhi_: 1dzh I: [42652]

Details for d1dzhi_

PDB Entry: 1dzh (more details), 2.85 Å

PDB Description: p14-fluorescein-n135q-s380c-antithrombin-iii

SCOP Domain Sequences for d1dzhi_:

Sequence, based on SEQRES records: (download)

>d1dzhi_ e.1.1.1 (I:) Antithrombin {Human (Homo sapiens)}
pvdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfattfy
qhladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfff
aklncrlyrkaqkssklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsr
aainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykad
gescsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpev
lqewldeleemmlvvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddly
vsdafhkaflevneegxeaaastavviagrslnpnrvtfkanrpflvfirevplntiifm
grvanpcv

Sequence, based on observed residues (ATOM records): (download)

>d1dzhi_ e.1.1.1 (I:) Antithrombin {Human (Homo sapiens)}
pvdictakprdipmnpmciyrspekkipeatnrrvwelskansrfattfyqhladskndn
dniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrk
aqkssklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnk
tegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmy
qegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldelee
mmlvvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkafl
evneegxeaaastavviagrslnpnrvtfkanrpflvfirevplntiifmgrvanpcv

SCOP Domain Coordinates for d1dzhi_:

Click to download the PDB-style file with coordinates for d1dzhi_.
(The format of our PDB-style files is described here.)

Timeline for d1dzhi_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dzhl_