Lineage for d1attb_ (1att B:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517080Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 517081Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 517082Family e.1.1.1: Serpins [56575] (15 proteins)
  6. 517093Protein Antithrombin [56584] (2 species)
  7. 517094Species Cow (Bos taurus) [TaxId:9913] [56585] (1 PDB entry)
  8. 517096Domain d1attb_: 1att B: [42639]

Details for d1attb_

PDB Entry: 1att (more details), 3.2 Å

PDB Description: crystal structure of cleaved bovine antithrombin iii at 3.2 angstroms resolution

SCOP Domain Sequences for d1attb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1attb_ e.1.1.1 (B:) Antithrombin {Cow (Bos taurus)}
kprdipvnpmciyrssqkipgatnrrvwelskanshfatafyqhladsknnndniflspl
sistafamtklgacnntltqlmevfkfdtisektsdqihfffaklncrlyrkanksselv
sanrlfgdksitfnetyqdisevvygaklqpldfkgnaeqsrltinqwisnktegritdv
ippqaineftvlvlvntiyfkglwkskfspentrkelfykadgescsvlmmyqeskfryr
rvaestqvlelpfkgdditmvlilpklektlakveqeltpdmlqewldeltetllvvhmp
rfriedsfsvkeqlqdmgledlfspeksrlpgivaegrsdlyvsdafhkaflevneegse
aaastvisiagrslnsdrvtfkanrpflvlirevalntiifmgrvanpcvd

SCOP Domain Coordinates for d1attb_:

Click to download the PDB-style file with coordinates for d1attb_.
(The format of our PDB-style files is described here.)

Timeline for d1attb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1atta_