Lineage for d1qgwb_ (1qgw B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879358Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 879359Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) (S)
    not a true superfamily
  5. 879360Family d.184.1.1: Phycoerythrin 545 alpha-subunits [56569] (1 protein)
    consists of a long beta-hairpin and a single alpha-helix
  6. 879361Protein Phycoerythrin 545 alpha-subunits [56570] (1 species)
  7. 879362Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [56571] (3 PDB entries)
    Uniprot P30943 38-104
    Uniprot Q00433 53-128
    Uniprot P30943 38-104 ! Uniprot Q00433 53-128
  8. 879368Domain d1qgwb_: 1qgw B: [42617]
    Other proteins in same PDB: d1qgwc_, d1qgwd_
    complexed with cl, dbv, mo6, peb

Details for d1qgwb_

PDB Entry: 1qgw (more details), 1.63 Å

PDB Description: crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24
PDB Compounds: (B:) protein (cryptophytan phycoerythrin (alpha-2 chain))

SCOP Domain Sequences for d1qgwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgwb_ d.184.1.1 (B:) Phycoerythrin 545 alpha-subunits {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]}
amdksakapvitifdhrgcsrapkeytgakaggkddemmvkaqsvkievstgtaegvlat
slakmtk

SCOP Domain Coordinates for d1qgwb_:

Click to download the PDB-style file with coordinates for d1qgwb_.
(The format of our PDB-style files is described here.)

Timeline for d1qgwb_: