Lineage for d1qgwa_ (1qgw A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049810Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 1049811Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) (S)
    not a true superfamily
  5. 1049812Family d.184.1.1: Phycoerythrin 545 alpha-subunits [56569] (1 protein)
    consists of a long beta-hairpin and a single alpha-helix
  6. 1049813Protein Phycoerythrin 545 alpha-subunits [56570] (1 species)
  7. 1049814Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [56571] (3 PDB entries)
    Uniprot P30943 38-104 ! Uniprot Q00433 53-128
  8. 1049819Domain d1qgwa_: 1qgw A: [42616]
    Other proteins in same PDB: d1qgwc_, d1qgwd_
    complexed with cl, dbv, mg, peb

Details for d1qgwa_

PDB Entry: 1qgw (more details), 1.63 Å

PDB Description: crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24
PDB Compounds: (A:) protein (cryptophytan phycoerythrin (alpha-1 chain))

SCOPe Domain Sequences for d1qgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgwa_ d.184.1.1 (A:) Phycoerythrin 545 alpha-subunits {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]}
amdksakapqitifdhrgcsrapkestggkaggqddemmvkvastkvtvsesdaakklqe
fitfekgidgpftskn

SCOPe Domain Coordinates for d1qgwa_:

Click to download the PDB-style file with coordinates for d1qgwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qgwa_: