SCOP 1.71: Domain d1qgwa_: 1qgw A:

Lineage for d1qgwa_ (1qgw A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
   not a true fold

4. Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families)
   not a true superfamily

5. Family d.184.1.1: Phycoerythrin 545 alpha-subunits [56569] (1 protein)
   consists of a long beta-hairpin and a single alpha-helix

6. Protein Phycoerythrin 545 alpha-subunits [56570] (1 species)

7. Species Cryptophyte (Rhodomonas sp.), cs24 [56571] (3 PDB entries)

8. Domain d1qgwa_: 1qgw A: [42616]
   Other proteins in same PDB: d1qgwc_, d1qgwd_

Details for d1qgwa_

PDB Entry: 1qgw, 1.63 Å

PDB Description: crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24

SCOP Domain Sequences for d1qgwa_:

Sequence; same for both SEQRES and ATOM records:

>d1qgwa_ d.184.1.1 (A:) Phycoerythrin 545 alpha-subunits {Cryptophyte (Rhodomonas sp.), cs24}
amdksakapqitifdhrgcsrapkestggkaggqddemmvkvastkvtvsesdaakklqe
fitfekgidgpftskn

Timeline for d1qgwa_:

• d1qgwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qgwa_ appears in SCOP 1.69
  
• d1qgwa_ appears in SCOP 1.73
  
• d1qgwa_ appears in the current release, SCOPe 2.08