Lineage for d1qgwa_ (1qgw A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86095Fold d.184: Non-globular alpha beta subunits of globular proteins [56567] (1 superfamily)
  4. 86096Superfamily d.184.1: Non-globular alpha beta subunits of globular proteins [56568] (1 family) (S)
  5. 86097Family d.184.1.1: Phycoerythrin 545 alpha-subunits [56569] (1 protein)
  6. 86098Protein Phycoerythrin 545 alpha-subunits [56570] (1 species)
  7. 86099Species Cryptophyte (Rhodomonas sp.), cs24 [56571] (1 PDB entry)
  8. 86100Domain d1qgwa_: 1qgw A: [42616]
    Other proteins in same PDB: d1qgwc_, d1qgwd_

Details for d1qgwa_

PDB Entry: 1qgw (more details), 1.63 Å

PDB Description: crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24

SCOP Domain Sequences for d1qgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgwa_ d.184.1.1 (A:) Phycoerythrin 545 alpha-subunits {Cryptophyte (Rhodomonas sp.), cs24}
amdksakapqitifdhrgcsrapkestggkaggqddemmvkvastkvtvsesdaakklqe
fitfekgidgpftskn

SCOP Domain Coordinates for d1qgwa_:

Click to download the PDB-style file with coordinates for d1qgwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qgwa_: