Lineage for d1fh6g_ (1fh6 G:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.183: Major capsid protein gp5 [56562] (1 superfamily) Superfamily d.183.1: Major capsid protein gp5 [56563] (1 family) 
Family d.183.1.1: Major capsid protein gp5 [56564] (1 protein) Protein Major capsid protein gp5 [56565] (1 species) Species Bacteriophage HK97 [TaxId:37554] [56566] (1 PDB entry) 
Domain d1fh6g_: 1fh6 G: [42615]
Details for d1fh6g_
PDB Entry: 1fh6 (more details), 3.6 Å
PDB Description: structure of the dsdna bacteriophage hk97 mature empty capsid
SCOP Domain Sequences for d1fh6g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fh6g_ d.183.1.1 (G:) Major capsid protein gp5 {Bacteriophage HK97}
slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
evsredrdnfvknmltilceerlalahyrptaiikgtfss
SCOP Domain Coordinates for d1fh6g_:
Click to download the PDB-style file with coordinates for d1fh6g_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fh6g_:
- d1fh6g_ first appeared (with stable ids) in SCOP 1.55
- d1fh6g_ appears in SCOP 1.59
- d1fh6g_ last appears in SCOP 1.65
View in 3D
