Lineage for d1fh6a_ (1fh6 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265205Fold d.183: Major capsid protein gp5 [56562] (1 superfamily)
    unusual fold
  4. 265206Superfamily d.183.1: Major capsid protein gp5 [56563] (1 family) (S)
  5. 265207Family d.183.1.1: Major capsid protein gp5 [56564] (1 protein)
  6. 265208Protein Major capsid protein gp5 [56565] (1 species)
  7. 265209Species Bacteriophage HK97 [TaxId:37554] [56566] (1 PDB entry)
  8. 265210Domain d1fh6a_: 1fh6 A: [42609]

Details for d1fh6a_

PDB Entry: 1fh6 (more details), 3.6 Å

PDB Description: structure of the dsdna bacteriophage hk97 mature empty capsid

SCOP Domain Sequences for d1fh6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fh6a_ d.183.1.1 (A:) Major capsid protein gp5 {Bacteriophage HK97}
slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
evsredrdnfvknmltilceerlalahyrptaiikgtfss

SCOP Domain Coordinates for d1fh6a_:

Click to download the PDB-style file with coordinates for d1fh6a_.
(The format of our PDB-style files is described here.)

Timeline for d1fh6a_: