Lineage for d1fzae1 (1fza E:200-460)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560074Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2560075Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2560076Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 2560077Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 2560084Species Human (Homo sapiens), beta [TaxId:9606] [68903] (14 PDB entries)
    Uniprot P02675
  8. 2560110Domain d1fzae1: 1fza E:200-460 [42482]
    Other proteins in same PDB: d1fzaa_, d1fzab2, d1fzac2, d1fzad_, d1fzae2, d1fzaf2
    complexed with ca, nag

Details for d1fzae1

PDB Entry: 1fza (more details), 2.9 Å

PDB Description: crystal structure of fibrinogen fragment d
PDB Compounds: (E:) fibrinogen

SCOPe Domain Sequences for d1fzae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzae1 d.171.1.1 (E:200-460) Fibrinogen C-terminal domains {Human (Homo sapiens), beta [TaxId: 9606]}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpffpq

SCOPe Domain Coordinates for d1fzae1:

Click to download the PDB-style file with coordinates for d1fzae1.
(The format of our PDB-style files is described here.)

Timeline for d1fzae1: