Lineage for d1fzac1 (1fza C:142-396)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
unusual foldSuperfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) 
Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins) Protein Fibrinogen C-terminal domains [56498] (7 species) Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (15 PDB entries) 
Domain d1fzac1: 1fza C:142-396 [42481]
Other proteins in same PDB: d1fzaa_, d1fzab2, d1fzac2, d1fzad_, d1fzae2, d1fzaf2
Details for d1fzac1
PDB Entry: 1fza (more details), 2.9 Å
PDB Description: crystal structure of fibrinogen fragment d
SCOP Domain Sequences for d1fzac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzac1 d.171.1.1 (C:142-396) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrltige
SCOP Domain Coordinates for d1fzac1:
Click to download the PDB-style file with coordinates for d1fzac1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fzac1:
- d1fzac1 first appeared (with stable ids) in SCOP 1.55
- d1fzac1 appears in SCOP 1.61
- d1fzac1 appears in SCOP 1.65
- d1fzac1 appears in the current release, SCOPe 2.08
View in 3D
