Lineage for d1fzbf1 (1fzb F:142-398)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337110Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 337111Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 337112Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 337113Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 337150Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (15 PDB entries)
  8. 337168Domain d1fzbf1: 1fzb F:142-398 [42475]
    Other proteins in same PDB: d1fzba_, d1fzbb2, d1fzbc2, d1fzbd_, d1fzbe2, d1fzbf2
    complexed with ca, nag

Details for d1fzbf1

PDB Entry: 1fzb (more details), 2.9 Å

PDB Description: crystal structure of crosslinked fragment d

SCOP Domain Sequences for d1fzbf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzbf1 d.171.1.1 (F:142-398) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrltigegq

SCOP Domain Coordinates for d1fzbf1:

Click to download the PDB-style file with coordinates for d1fzbf1.
(The format of our PDB-style files is described here.)

Timeline for d1fzbf1: