Lineage for d1fzbf1 (1fzb F:142-398)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.171: Fibrinogen C-terminal domains [56495] (1 superfamily) Superfamily d.171.1: Fibrinogen C-terminal domains [56496] (1 family) 
Family d.171.1.1: Fibrinogen C-terminal domains [56497] (1 protein) Protein Fibrinogen C-terminal domains [56498] (2 species) Species Human (Homo sapiens), beta and gamma [TaxId:9606] [56499] (11 PDB entries) 
Domain d1fzbf1: 1fzb F:142-398 [42475]
Other proteins in same PDB: d1fzba1, d1fzbb2, d1fzbc2, d1fzbd1, d1fzbe2, d1fzbf2
Details for d1fzbf1
PDB Entry: 1fzb (more details), 2.9 Å
PDB Description: crystal structure of crosslinked fragment d
SCOP Domain Sequences for d1fzbf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzbf1 d.171.1.1 (F:142-398) Fibrinogen C-terminal domains {Human (Homo sapiens), beta and gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrltigegq
SCOP Domain Coordinates for d1fzbf1:
Click to download the PDB-style file with coordinates for d1fzbf1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fzbf1:
View in 3D
