SCOP 1.75: Domain d1fzgb1: 1fzg B:200-459

Lineage for d1fzgb1 (1fzg B:200-459)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family)

5. Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)

6. Protein Fibrinogen C-terminal domains [56498] (7 species)

7. Species Human (Homo sapiens), beta [TaxId:9606] [68903] (14 PDB entries)
   Uniprot P02675

8. Domain d1fzgb1: 1fzg B:200-459 [42468]
   Other proteins in same PDB: d1fzga_, d1fzgb2, d1fzgc2, d1fzgd_, d1fzge2, d1fzgf2

Details for d1fzgb1

PDB Entry: 1fzg, 2.5 Å

PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide

PDB Compounds: (B:) fibrinogen

SCOP Domain Sequences for d1fzgb1:

Sequence; same for both SEQRES and ATOM records:

>d1fzgb1 d.171.1.1 (B:200-459) Fibrinogen C-terminal domains {Human (Homo sapiens), beta [TaxId: 9606]}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpffp

Timeline for d1fzgb1:

• d1fzgb1 first appeared (with stable ids) in SCOP 1.55
  
• d1fzgb1 appears in SCOP 1.73
  
• d1fzgb1 appears in SCOPe 2.01
  
• d1fzgb1 appears in the current release, SCOPe 2.08