Lineage for d1fzff1 (1fzf F:142-393)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614810Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 614811Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 614812Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 614813Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 614858Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (19 PDB entries)
  8. 614872Domain d1fzff1: 1fzf F:142-393 [42467]
    Other proteins in same PDB: d1fzfa_, d1fzfb2, d1fzfc2, d1fzfd_, d1fzfe2, d1fzff2
    complexed with ca, nag

Details for d1fzff1

PDB Entry: 1fzf (more details), 2.7 Å

PDB Description: crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzff1 d.171.1.1 (F:142-393) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlt

SCOP Domain Coordinates for d1fzff1:

Click to download the PDB-style file with coordinates for d1fzff1.
(The format of our PDB-style files is described here.)

Timeline for d1fzff1: