SCOP 1.65: Domain d1fzcf1: 1fzc F:142-397

Lineage for d1fzcf1 (1fzc F:142-397)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family)

5. Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)

6. Protein Fibrinogen C-terminal domains [56498] (7 species)

7. Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (15 PDB entries)

8. Domain d1fzcf1: 1fzc F:142-397 [42463]
   Other proteins in same PDB: d1fzca_, d1fzcb2, d1fzcc2, d1fzcd_, d1fzce2, d1fzcf2
   complexed with ca, man, nag

Details for d1fzcf1

PDB Entry: 1fzc, 2.3 Å

PDB Description: crystal structure of fragment double-d from human fibrin with two different bound ligands

SCOP Domain Sequences for d1fzcf1:

Sequence; same for both SEQRES and ATOM records:

>d1fzcf1 d.171.1.1 (F:142-397) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrltigeg

Timeline for d1fzcf1:

• d1fzcf1 first appeared (with stable ids) in SCOP 1.55
  
• d1fzcf1 appears in SCOP 1.63
  
• d1fzcf1 appears in SCOP 1.67
  
• d1fzcf1 appears in the current release, SCOPe 2.08