SCOP 1.65: Domain d1bcpc2: 1bcp C:4-89

Lineage for d1bcpc2 (1bcp C:4-89)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (2 proteins)

6. Protein Pertussis toxin, S2/S3 subunits, N-terminal domain [56468] (1 species)

7. Species Bordetella pertussis [TaxId:520] [56469] (3 PDB entries)

8. Domain d1bcpc2: 1bcp C:4-89 [42430]
   Other proteins in same PDB: d1bcpa_, d1bcpb1, d1bcpc1, d1bcpd_, d1bcpe_, d1bcpf_, d1bcpg_, d1bcph1, d1bcpi1, d1bcpj_, d1bcpk_, d1bcpl_

Details for d1bcpc2

PDB Entry: 1bcp, 2.7 Å

PDB Description: binary complex of pertussis toxin and atp

SCOP Domain Sequences for d1bcpc2:

Sequence; same for both SEQRES and ATOM records:

>d1bcpc2 d.169.1.2 (C:4-89) Pertussis toxin, S2/S3 subunits, N-terminal domain {Bordetella pertussis}
givippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpgwsiyglydgtyl
gqayggiikdappgagfiyretfcit

Timeline for d1bcpc2:

• d1bcpc2 first appeared (with stable ids) in SCOP 1.55
  
• d1bcpc2 appears in SCOP 1.63
  
• d1bcpc2 appears in SCOP 1.67
  
• d1bcpc2 appears in the current release, SCOPe 2.08