![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (3 proteins) automatically mapped to Pfam PF03440 |
![]() | Protein Pertussis toxin, S2/S3 subunits, N-terminal domain [56468] (1 species) |
![]() | Species Bordetella pertussis [TaxId:520] [56469] (3 PDB entries) |
![]() | Domain d1bcpb2: 1bcp B:3-89 [42429] Other proteins in same PDB: d1bcpa_, d1bcpb1, d1bcpc1, d1bcpd_, d1bcpe_, d1bcpf_, d1bcpg_, d1bcph1, d1bcpi1, d1bcpj_, d1bcpk_, d1bcpl_ complexed with atp |
PDB Entry: 1bcp (more details), 2.7 Å
SCOPe Domain Sequences for d1bcpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcpb2 d.169.1.2 (B:3-89) Pertussis toxin, S2/S3 subunits, N-terminal domain {Bordetella pertussis [TaxId: 520]} pgivippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydgty lggeyggvikdgtpggafdlkttfcim
Timeline for d1bcpb2: