Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) |
Superfamily d.169.1: C-type lectin-like [56436] (5 families) |
Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (2 proteins) |
Protein Pertussis toxin, S2/S3 subunits, N-terminal domain [56468] (1 species) |
Species Bordetella pertussis [TaxId:520] [56469] (3 PDB entries) |
Domain d1prth2: 1prt H:4-89 [42427] Other proteins in same PDB: d1prta_, d1prtb1, d1prtc1, d1prtd_, d1prte_, d1prtf_, d1prtg_, d1prth1, d1prti1, d1prtj_, d1prtk_, d1prtl_ |
PDB Entry: 1prt (more details), 2.9 Å
SCOP Domain Sequences for d1prth2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1prth2 d.169.1.2 (H:4-89) Pertussis toxin, S2/S3 subunits, N-terminal domain {Bordetella pertussis} givippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydgtyl ggeyggvikdgtpggafdlkttfcim
Timeline for d1prth2: