SCOPe 2.04: Domain d1b08b1: 1b08 B:1235-1355

Lineage for d1b08b1 (1b08 B:1235-1355)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Surfactant protein, lectin domain [56461] (3 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (9 PDB entries)

8. Domain d1b08b1: 1b08 B:1235-1355 [42417]
   Other proteins in same PDB: d1b08a2, d1b08b2, d1b08c2
   complexed with ca

Details for d1b08b1

PDB Entry: 1b08, 2.3 Å

PDB Description: lung surfactant protein d (sp-d) (fragment)

PDB Compounds: (B:) protein (lung surfactant protein d)

SCOPe Domain Sequences for d1b08b1:

Sequence; same for both SEQRES and ATOM records:

>d1b08b1 d.169.1.1 (B:1235-1355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

Timeline for d1b08b1:

• d1b08b1 first appeared (with stable ids) in SCOP 1.55
  
• d1b08b1 appears in SCOPe 2.03
  
• d1b08b1 appears in SCOPe 2.05
  
• d1b08b1 appears in the current release, SCOPe 2.08