Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Surfactant protein, lectin domain [56461] (3 species) |
Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (9 PDB entries) |
Domain d1b08b1: 1b08 B:1235-1355 [42417] Other proteins in same PDB: d1b08a2, d1b08b2, d1b08c2 complexed with ca |
PDB Entry: 1b08 (more details), 2.3 Å
SCOPe Domain Sequences for d1b08b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b08b1 d.169.1.1 (B:1235-1355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce f
Timeline for d1b08b1:
View in 3D Domains from other chains: (mouse over for more information) d1b08a1, d1b08a2, d1b08c1, d1b08c2 |