Lineage for d1b08b1 (1b08 B:1235-1355)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442937Protein Surfactant protein, lectin domain [56461] (3 species)
  7. 1442938Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (9 PDB entries)
  8. 1442964Domain d1b08b1: 1b08 B:1235-1355 [42417]
    Other proteins in same PDB: d1b08a2, d1b08b2, d1b08c2
    complexed with ca

Details for d1b08b1

PDB Entry: 1b08 (more details), 2.3 Å

PDB Description: lung surfactant protein d (sp-d) (fragment)
PDB Compounds: (B:) protein (lung surfactant protein d)

SCOPe Domain Sequences for d1b08b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b08b1 d.169.1.1 (B:1235-1355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d1b08b1:

Click to download the PDB-style file with coordinates for d1b08b1.
(The format of our PDB-style files is described here.)

Timeline for d1b08b1: