SCOP 1.55: Domain d1b08a1: 1b08 A:235-355

Lineage for d1b08a1 (1b08 A:235-355)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)

4. Superfamily d.169.1: C-type lectin-like [56436] (5 families)

5. Family d.169.1.1: C-type lectin domain [56437] (13 proteins)

6. Protein Surfactant protein, lectin domain [56461] (1 species)
7. Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (1 PDB entry)
8. Domain d1b08a1: 1b08 A:235-355 [42416]
   Other proteins in same PDB: d1b08a2, d1b08b2, d1b08c2

Details for d1b08a1

PDB Entry: 1b08, 2.3 Å

PDB Description: lung surfactant protein d (sp-d) (fragment)

SCOP Domain Sequences for d1b08a1:

Sequence; same for both SEQRES and ATOM records:

>d1b08a1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOP Domain Coordinates for d1b08a1 are not available.

Timeline for d1b08a1:

• d1b08a1 appears in SCOP 1.57
  
• d1b08a1 appears in the current release, SCOPe 2.08