Lineage for d7vvrh_ (7vvr H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714739Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714740Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2714741Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2714742Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2714743Species Cow (Bos taurus) [TaxId:9913] [47697] (33 PDB entries)
  8. 3087357Domain d7vvrh_: 7vvr H: [423674]
    Other proteins in same PDB: d7vvra_, d7vvrb1, d7vvrb2, d7vvrc_, d7vvrd_, d7vvre_, d7vvrf_, d7vvrg_, d7vvri_, d7vvrj_, d7vvrk_, d7vvrl_, d7vvrm_, d7vvrn_, d7vvro1, d7vvro2, d7vvrp_, d7vvrq_, d7vvrr_, d7vvrs_, d7vvrt_, d7vvrv_, d7vvrw_, d7vvrx_, d7vvry_, d7vvrz_
    automated match to d1v54h_
    complexed with cdl, chd, cu, cua, cyn, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d7vvrh_

PDB Entry: 7vvr (more details), 1.65 Å

PDB Description: bovine cytochrome c oxidese in cn-bound mixed valence state at 50 k
PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d7vvrh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vvrh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d7vvrh_:

Click to download the PDB-style file with coordinates for d7vvrh_.
(The format of our PDB-style files is described here.)

Timeline for d7vvrh_:

  • d7vvrh_ is new in SCOPe 2.08-stable