Lineage for d7vvro2 (7vvr O:91-227)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771045Species Cow (Bos taurus) [TaxId:9913] [49545] (50 PDB entries)
  8. 3087356Domain d7vvro2: 7vvr O:91-227 [423673]
    Other proteins in same PDB: d7vvra_, d7vvrb1, d7vvrc_, d7vvrd_, d7vvre_, d7vvrf_, d7vvrg_, d7vvrh_, d7vvri_, d7vvrj_, d7vvrk_, d7vvrl_, d7vvrm_, d7vvrn_, d7vvro1, d7vvrp_, d7vvrq_, d7vvrr_, d7vvrs_, d7vvrt_, d7vvru_, d7vvrv_, d7vvrw_, d7vvrx_, d7vvry_, d7vvrz_
    automated match to d1occb1
    complexed with cdl, chd, cu, cua, cyn, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d7vvro2

PDB Entry: 7vvr (more details), 1.65 Å

PDB Description: bovine cytochrome c oxidese in cn-bound mixed valence state at 50 k
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d7vvro2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vvro2 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d7vvro2:

Click to download the PDB-style file with coordinates for d7vvro2.
(The format of our PDB-style files is described here.)

Timeline for d7vvro2:

  • d7vvro2 is new in SCOPe 2.08-stable