Lineage for d7vvre_ (7vvr E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727193Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2727194Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2727293Protein automated matches [254653] (1 species)
    not a true protein
  7. 2727294Species Cow (Bos taurus) [TaxId:9913] [255695] (7 PDB entries)
  8. 3087335Domain d7vvre_: 7vvr E: [423652]
    Other proteins in same PDB: d7vvra_, d7vvrb1, d7vvrb2, d7vvrc_, d7vvrd_, d7vvrf_, d7vvrg_, d7vvrh_, d7vvri_, d7vvrj_, d7vvrk_, d7vvrl_, d7vvrm_, d7vvrn_, d7vvro1, d7vvro2, d7vvrp_, d7vvrq_, d7vvrs_, d7vvrt_, d7vvru_, d7vvrv_, d7vvrw_, d7vvrx_, d7vvry_, d7vvrz_
    automated match to d1ocre_
    complexed with cdl, chd, cu, cua, cyn, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d7vvre_

PDB Entry: 7vvr (more details), 1.65 Å

PDB Description: bovine cytochrome c oxidese in cn-bound mixed valence state at 50 k
PDB Compounds: (E:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d7vvre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vvre_ a.118.11.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d7vvre_:

Click to download the PDB-style file with coordinates for d7vvre_.
(The format of our PDB-style files is described here.)

Timeline for d7vvre_:

  • d7vvre_ is new in SCOPe 2.08-stable