SCOPe 2.08: Domain d7vvrc_: 7vvr C:

Lineage for d7vvrc_ (7vvr C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)

8. Domain d7vvrc_: 7vvr C: [423613]
   Other proteins in same PDB: d7vvra_, d7vvrb1, d7vvrb2, d7vvrd_, d7vvre_, d7vvrf_, d7vvrg_, d7vvrh_, d7vvri_, d7vvrj_, d7vvrk_, d7vvrl_, d7vvrm_, d7vvrn_, d7vvro1, d7vvro2, d7vvrq_, d7vvrr_, d7vvrs_, d7vvrt_, d7vvru_, d7vvrv_, d7vvrw_, d7vvrx_, d7vvry_, d7vvrz_
   automated match to d3ag3c_
   complexed with cdl, chd, cu, cua, cyn, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d7vvrc_

PDB Entry: 7vvr, 1.65 Å

PDB Description: bovine cytochrome c oxidese in cn-bound mixed valence state at 50 k

PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d7vvrc_:

Sequence; same for both SEQRES and ATOM records:

>d7vvrc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d7vvrc_:

• d7vvrc_ is new in SCOPe 2.08-stable