Lineage for d1esl_1 (1esl 1-118)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614376Protein E-selectin, C-lectin domain [56456] (1 species)
    folowed by EGF-like module
  7. 614377Species Human (Homo sapiens) [TaxId:9606] [56457] (2 PDB entries)
  8. 614379Domain d1esl_1: 1esl 1-118 [42353]
    Other proteins in same PDB: d1esl_2
    complexed with ca, cl

Details for d1esl_1

PDB Entry: 1esl (more details), 2 Å

PDB Description: insight into e-selectin(slash)ligand interaction from the crystal structure and mutagenesis of the lec(slash)egf domains

SCOP Domain Sequences for d1esl_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esl_1 d.169.1.1 (1-118) E-selectin, C-lectin domain {Human (Homo sapiens)}
wsyntsteamtydeasaycqqrythlvaiqnkeeieylnsilsyspsyywigirkvnnvw
vwvgtqkplteeaknwapgepnnrqkdedcveiyikrekdvgmwndercskkklalcy

SCOP Domain Coordinates for d1esl_1:

Click to download the PDB-style file with coordinates for d1esl_1.
(The format of our PDB-style files is described here.)

Timeline for d1esl_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1esl_2