Lineage for d1qo3c_ (1qo3 C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614534Protein NK cell receptor [56452] (3 species)
  7. 614535Species Mouse (Mus musculus), ly49-a [TaxId:10090] [56453] (1 PDB entry)
  8. 614536Domain d1qo3c_: 1qo3 C: [42350]
    Other proteins in same PDB: d1qo3a1, d1qo3a2, d1qo3b_

Details for d1qo3c_

PDB Entry: 1qo3 (more details), 2.3 Å

PDB Description: complex between nk cell receptor ly49a and its mhc class i ligand h-2dd
PDB Compounds: (C:)

SCOP Domain Sequences for d1qo3c_:

Sequence, based on SEQRES records: (download)

>d1qo3c_ d.169.1.1 (C:) NK cell receptor {Mouse (Mus musculus), ly49-a}
stvldslqhtgrgdkvywfcygmkcyyfvmdrktwsgckqtcqssslsllkiddedelkf
lqlvvpsdscwvglsydnkkkdwawidnrpsklalntrkynirdggcmllsktrldngnc
dqvficicgkrld

Sequence, based on observed residues (ATOM records): (download)

>d1qo3c_ d.169.1.1 (C:) NK cell receptor {Mouse (Mus musculus), ly49-a}
stvldslqhkvywfcygmkcyyfvmdrktwsgckqtcqssslsllkiddedelkflqlvv
psdscwvglsydnkkkdwawidnrpsklalntrkynirdggcmllsktrldngncdqvfi
cicgkrld

SCOP Domain Coordinates for d1qo3c_:

Click to download the PDB-style file with coordinates for d1qo3c_.
(The format of our PDB-style files is described here.)

Timeline for d1qo3c_: