SCOP 1.63: Domain d1fvuc_: 1fvu C:

Lineage for d1fvuc_ (1fvu C:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (18 proteins)

6. Protein Snake coagglutinin [56446] (5 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [56449] (2 PDB entries)

8. Domain d1fvuc_: 1fvu C: [42347]

Details for d1fvuc_

PDB Entry: 1fvu, 1.8 Å

PDB Description: crystal structure of botrocetin

SCOP Domain Sequences for d1fvuc_:

Sequence; same for both SEQRES and ATOM records:

>d1fvuc_ d.169.1.1 (C:) Snake coagglutinin {Jararaca (Bothrops jararaca), botrocetin}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp

Timeline for d1fvuc_:

• d1fvuc_ first appeared (with stable ids) in SCOP 1.55
  
• d1fvuc_ appears in SCOP 1.61
  
• d1fvuc_ appears in SCOP 1.65
  
• d1fvuc_ appears in the current release, SCOPe 2.08