SCOPe 2.08: Domain d1bj3a_: 1bj3 A:

Lineage for d1bj3a_ (1bj3 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin alpha chain [88861] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (6 PDB entries)

8. Domain d1bj3a_: 1bj3 A: [42341]
   Other proteins in same PDB: d1bj3b_
   complexed with ca

Details for d1bj3a_

PDB Entry: 1bj3, 2.6 Å

PDB Description: crystal structure of coagulation factor ix-binding protein (ix-bp) from venom of habu snake with a heterodimer of c-type lectin domains

PDB Compounds: (A:) protein (coagulation factor ix-binding protein a)

SCOPe Domain Sequences for d1bj3a_:

Sequence; same for both SEQRES and ATOM records:

>d1bj3a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
qqnpfvcea

Timeline for d1bj3a_:

• d1bj3a_ first appeared (with stable ids) in SCOP 1.55
  
• d1bj3a_ appears in SCOPe 2.07