SCOP 1.65: Domain d1ixxa_: 1ixx A:

Lineage for d1ixxa_ (1ixx A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (21 proteins)

6. Protein Snake coagglutinin alpha chain [88861] (5 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (4 PDB entries)

8. Domain d1ixxa_: 1ixx A: [42335]
   Other proteins in same PDB: d1ixxb_, d1ixxd_, d1ixxf_

Details for d1ixxa_

PDB Entry: 1ixx, 2.5 Å

PDB Description: crystal structure of coagulation factors ix/x-binding protein (ix/x-bp) from venom of habu snake with a heterodimer of c-type lectin domains

SCOP Domain Sequences for d1ixxa_:

Sequence; same for both SEQRES and ATOM records:

>d1ixxa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis)}
dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk
rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg
qqnpfvcea

Timeline for d1ixxa_:

• d1ixxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ixxa_ appears in SCOP 1.63
  
• d1ixxa_ appears in SCOP 1.67
  
• d1ixxa_ appears in the current release, SCOPe 2.08