Lineage for d7zy9a_ (7zy9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833262Species Trichoderma harzianum [TaxId:5544] [319250] (6 PDB entries)
  8. 3087009Domain d7zy9a_: 7zy9 A: [423326]
    automated match to d1cnva_
    complexed with nag; mutant

Details for d7zy9a_

PDB Entry: 7zy9 (more details), 1.6 Å

PDB Description: structure of d165a/d167a double mutant of chit33 from trichoderma harzianum complexed with chitintetraose.
PDB Compounds: (A:) Endochitinase 33

SCOPe Domain Sequences for d7zy9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7zy9a_ c.1.8.0 (A:) automated matches {Trichoderma harzianum [TaxId: 5544]}
agwnvnskqniavywgqnsansqstqqrlsfycndaninvidiaflngitppmtnfanag
drctpfsdnpwllqcpeieadiktcqangktillslggdsytqggwsstgaaqsaadqvw
amfgpvqsgssvhrpfgsavvdgfdfafaattnnlaafgaqlksrtnaaggkkyyfsaap
qcffpdaavgalinavpmdwiqiqfynnpcgvsgftpgtstqnnynyqtwenwaktspnp
nvkllvgipagpgagrgyvsgsqltsvfqyskgfstfagammwdmsqlyqntgfetqvvn
alr

SCOPe Domain Coordinates for d7zy9a_:

Click to download the PDB-style file with coordinates for d7zy9a_.
(The format of our PDB-style files is described here.)

Timeline for d7zy9a_:

  • d7zy9a_ is new in SCOPe 2.08-stable