Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d7y0gj_: 7y0g J: [423308] Other proteins in same PDB: d7y0gb_, d7y0ge_, d7y0gh_, d7y0gk_ automated match to d7orbb_ complexed with p15 |
PDB Entry: 7y0g (more details), 2.08 Å
SCOPe Domain Sequences for d7y0gj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7y0gj_ b.1.1.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitckasqdvntavawyqqkpgkapklliywastrhtgvps rfsgsgsgtdftftisslqpediatyyclqyinypytfgqgtkleikrtvaapsvfifpp sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt lskadyekhkvyacevthqglsspvtksfnr
Timeline for d7y0gj_: