SCOPe 2.08: Domain d7zzna2: 7zzn A:82-217

Lineage for d7zzna2 (7zzn A:82-217)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [326861] (11 PDB entries)

8. Domain d7zzna2: 7zzn A:82-217 [423292]
   Other proteins in same PDB: d7zzna1
   automated match to d5o84a2
   complexed with ca

Details for d7zzna2

PDB Entry: 7zzn, 2.01 Å

PDB Description: crystal structure of poplar glutathione transferase u20

PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d7zzna2:

Sequence; same for both SEQRES and ATOM records:

>d7zzna2 a.45.1.0 (A:82-217) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
llptdpyeramarfwiqygatktaafgalfrasgeelekaakevvevlrvleeqglgdkk
ffggdsinlvdisfglftcwleaieeaagvkvlepstlprlhawaqnfievplikenipd
ydklllhmkgvrekmm

Timeline for d7zzna2:

• d7zzna2 is new in SCOPe 2.08-stable