SCOPe 2.08: Domain d7zzna1: 7zzn A:3-81

Lineage for d7zzna1 (7zzn A:3-81)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (13 PDB entries)

8. Domain d7zzna1: 7zzn A:3-81 [423291]
   Other proteins in same PDB: d7zzna2
   automated match to d5o84a1
   complexed with ca

Details for d7zzna1

PDB Entry: 7zzn, 2.01 Å

PDB Description: crystal structure of poplar glutathione transferase u20

PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d7zzna1:

Sequence, based on SEQRES records:

>d7zzna1 c.47.1.0 (A:3-81) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
dvklhgswvspfnyrviwalklkgvefehivedltnkselllkynpvykkipvlvhggkp
iaeslvileyieetwpenp

Sequence, based on observed residues (ATOM records):

>d7zzna1 c.47.1.0 (A:3-81) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
dvklhgswvspfnyrviwalklkgvefehivkipvlvhggkpiaeslvileyieetwpen
p

Timeline for d7zzna1:

• d7zzna1 is new in SCOPe 2.08-stable