Lineage for d7ukof_ (7uko F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 3084149Species Mus musculus [TaxId:10090] [420466] (16 PDB entries)
  8. 3086967Domain d7ukof_: 7uko F: [423284]
    Other proteins in same PDB: d7ukoa_, d7ukoc_, d7ukoe_, d7ukoh_
    automated match to d6shgl_
    complexed with ca, cl, gol, mn, nag, so4, xqs

Details for d7ukof_

PDB Entry: 7uko (more details), 2.6 Å

PDB Description: integrin alaphiibbeta3 complex with sibrafiban (mn)
PDB Compounds: (F:) 10e5 fab light chain

SCOPe Domain Sequences for d7ukof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ukof_ b.1.1.0 (F:) automated matches {Mus musculus [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d7ukof_:

Click to download the PDB-style file with coordinates for d7ukof_.
(The format of our PDB-style files is described here.)

Timeline for d7ukof_:

  • d7ukof_ is new in SCOPe 2.08-stable