Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mus musculus [TaxId:10090] [420466] (16 PDB entries) |
Domain d7ukof_: 7uko F: [423284] Other proteins in same PDB: d7ukoa_, d7ukoc_, d7ukoe_, d7ukoh_ automated match to d6shgl_ complexed with ca, cl, gol, mn, nag, so4, xqs |
PDB Entry: 7uko (more details), 2.6 Å
SCOPe Domain Sequences for d7ukof_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ukof_ b.1.1.0 (F:) automated matches {Mus musculus [TaxId: 10090]} dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleikradaaptvsifpp sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt ltkdeyerhnsytceathktstspivksfnrnec
Timeline for d7ukof_: