Lineage for d7vcqh_ (7vcq H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698447Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)
  8. 3086965Domain d7vcqh_: 7vcq H: [423282]
    Other proteins in same PDB: d7vcqa_, d7vcqc_, d7vcqd_, d7vcqf_, d7vcqg_, d7vcqi_
    automated match to d1kx5b_

Details for d7vcqh_

PDB Entry: 7vcq (more details), 3 Å

PDB Description: structure of viral protein bkrf4 in complex with h3.3-h4-asf1
PDB Compounds: (H:) histone h4

SCOPe Domain Sequences for d7vcqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vcqh_ a.22.1.1 (H:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfg

SCOPe Domain Coordinates for d7vcqh_:

Click to download the PDB-style file with coordinates for d7vcqh_.
(The format of our PDB-style files is described here.)

Timeline for d7vcqh_:

  • d7vcqh_ is new in SCOPe 2.08-stable