Lineage for d7udgl_ (7udg L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 3084149Species Mus musculus [TaxId:10090] [420466] (16 PDB entries)
  8. 3086944Domain d7udgl_: 7udg L: [423261]
    Other proteins in same PDB: d7udga_, d7udgc_, d7udge_, d7udgh_
    automated match to d6shgl_
    complexed with ca, cl, mg, mwi, nag, so4

Details for d7udgl_

PDB Entry: 7udg (more details), 2.8 Å

PDB Description: integrin alaphiibbeta3 complex with lotrafiban
PDB Compounds: (L:) 10e5 fab light chain

SCOPe Domain Sequences for d7udgl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7udgl_ b.1.1.0 (L:) automated matches {Mus musculus [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d7udgl_:

Click to download the PDB-style file with coordinates for d7udgl_.
(The format of our PDB-style files is described here.)

Timeline for d7udgl_:

  • d7udgl_ is new in SCOPe 2.08-stable