Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.22: ASF1-like [101546] (2 families) contains extra C-terminal strand automatically mapped to Pfam PF04729 |
Family b.1.22.1: ASF1-like [101547] (2 proteins) |
Protein automated matches [195145] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [273850] (3 PDB entries) |
Domain d7vcqi_: 7vcq I: [423256] Other proteins in same PDB: d7vcqa_, d7vcqb_, d7vcqc_, d7vcqe_, d7vcqg_, d7vcqh_ automated match to d1teya1 |
PDB Entry: 7vcq (more details), 3 Å
SCOPe Domain Sequences for d7vcqi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7vcqi_ b.1.22.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} akvsvlnvavlenpspfhspfrfeisfecsealaddlewkiiyvgsaeseefdqildsvl vgpvpagrhmfvfqadapnpslipetdavgvtvvlitctyhgqefirvgyyvnneylnpe lrenppmkpdfsqlqrnilasnprvtrfhinwd
Timeline for d7vcqi_: