Lineage for d7vcqi_ (7vcq I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766651Superfamily b.1.22: ASF1-like [101546] (2 families) (S)
    contains extra C-terminal strand
    automatically mapped to Pfam PF04729
  5. 2766652Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 2766678Protein automated matches [195145] (3 species)
    not a true protein
  7. 2766693Species Human (Homo sapiens) [TaxId:9606] [273850] (3 PDB entries)
  8. 3086939Domain d7vcqi_: 7vcq I: [423256]
    Other proteins in same PDB: d7vcqa_, d7vcqb_, d7vcqc_, d7vcqe_, d7vcqg_, d7vcqh_
    automated match to d1teya1

Details for d7vcqi_

PDB Entry: 7vcq (more details), 3 Å

PDB Description: structure of viral protein bkrf4 in complex with h3.3-h4-asf1
PDB Compounds: (I:) Histone chaperone ASF1B

SCOPe Domain Sequences for d7vcqi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vcqi_ b.1.22.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akvsvlnvavlenpspfhspfrfeisfecsealaddlewkiiyvgsaeseefdqildsvl
vgpvpagrhmfvfqadapnpslipetdavgvtvvlitctyhgqefirvgyyvnneylnpe
lrenppmkpdfsqlqrnilasnprvtrfhinwd

SCOPe Domain Coordinates for d7vcqi_:

Click to download the PDB-style file with coordinates for d7vcqi_.
(The format of our PDB-style files is described here.)

Timeline for d7vcqi_:

  • d7vcqi_ is new in SCOPe 2.08-stable