Lineage for d7v1ja1 (7v1j A:6-264)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 3086906Species Omsk hemorrhagic fever virus [TaxId:12542] [423223] (1 PDB entry)
  8. 3086907Domain d7v1ja1: 7v1j A:6-264 [423224]
    Other proteins in same PDB: d7v1ja2
    automated match to d3elwa_
    complexed with gta, sah

Details for d7v1ja1

PDB Entry: 7v1j (more details), 1.98 Å

PDB Description: crystal structure of omsk hemorrhagic fever virus ns5 mtase (in complex with sah and m7gpppa)
PDB Compounds: (A:) Core protein

SCOPe Domain Sequences for d7v1ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7v1ja1 c.66.1.0 (A:6-264) automated matches {Omsk hemorrhagic fever virus [TaxId: 12542]}
mtlgdlwkrrlnnctkeeffayrrtgileterdkarellrkgetnmglavsrgtaklawl
eergyvnlkgevvdlgcgrggwsyyaasrpavmgvkaytiggkgheapkmvtslgwnlik
fragmdvftmqphradtvmcdigesspdaaiegertrkvillmeqwknrnpsascvfkvl
apyrpeviealhrfqlqwggglvrtpfsrnsthemyystaisgnivnsvnvqsrkllarf
gdqrgpirvpemdlgvgtr

SCOPe Domain Coordinates for d7v1ja1:

Click to download the PDB-style file with coordinates for d7v1ja1.
(The format of our PDB-style files is described here.)

Timeline for d7v1ja1:

  • d7v1ja1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7v1ja2